Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PCK1 antibody (Soluble)

PCK1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN631057
  • Target See all PCK1 Antibodies
    PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
    Binding Specificity
    • 15
    • 9
    • 8
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Soluble
    Reactivity
    • 73
    • 54
    • 29
    • 8
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 87
    • 9
    • 2
    • 2
    Rabbit
    Clonality
    • 84
    • 16
    Polyclonal
    Conjugate
    • 47
    • 9
    • 6
    • 6
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    This PCK1 antibody is un-conjugated
    Application
    • 83
    • 38
    • 27
    • 15
    • 14
    • 13
    • 10
    • 9
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogen
    PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE
    Top Product
    Discover our top product PCK1 Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    PCK1 Blocking Peptide, catalog no. 33R-7272, is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
    Alternative Name
    PCK1 (PCK1 Products)
    Synonyms
    PEPCK-C antibody, PEPCK1 antibody, PEPCKC antibody, PEPCK antibody, PEPCK-M antibody, PEPCK2 antibody, 1810010O14Rik antibody, 9130022B02Rik antibody, cb856 antibody, cb924 antibody, fj93h11 antibody, zgc:63869 antibody, wu:fc51c05 antibody, wu:fj93h11 antibody, pepck-c antibody, pepck1 antibody, pepckc antibody, PCK1 antibody, PPCK1 antibody, AI265463 antibody, Pck-1 antibody, GTP antibody, PCK antibody, Pepck antibody, RATPEPCK antibody, Ppc1C antibody, PHOSPHOENOLPYRUVATE CARBOXYKINASE antibody, T28I19.150 antibody, T28I19_150 antibody, phosphoenolpyruvate carboxykinase 1 antibody, 143299_at antibody, CG10924 antibody, CG17725 antibody, Dmel\\CG17725 antibody, Dromel_CG17725_FBtr0086701_pepck_mORF antibody, dPEPCK antibody, pepck antibody, PEPC antibody, PEPCase antibody, ppc antibody, phosphoenolpyruvate carboxykinase 1 antibody, phosphoenolpyruvate carboxykinase 2, mitochondrial antibody, phosphoenolpyruvate carboxykinase 2 (mitochondrial) antibody, phosphoenolpyruvate carboxykinase 1 (soluble) antibody, phosphoenolpyruvate carboxykinase 1 S homeolog antibody, phosphoenolpyruvate carboxykinase, cytosolic [GTP] antibody, phosphoenolpyruvate carboxykinase 1, cytosolic antibody, phosphoenolpyruvate carboxylase 7 antibody, Phosphoenolpyruvate carboxykinase antibody, phosphoenolpyruvate carboxylase antibody, PCK1 antibody, PCK2 antibody, Pck2 antibody, pck1 antibody, pck1.S antibody, LOC100634531 antibody, Pck1 antibody, pep7 antibody, Pepck antibody, LOC107777405 antibody
    Background
    PCK1 is a main control point for the regulation of gluconeogenesis. PCK1, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized.
    Molecular Weight
    69 kDa (MW of target protein)
    Pathways
    Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis
You are here:
Support