Vimentin antibody (N-Term)
-
- Target See all Vimentin (VIM) Antibodies
- Vimentin (VIM)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Vimentin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Vimentin antibody was raised against the N terminal of VIM
- Purification
- Affinity purified
- Immunogen
- Vimentin antibody was raised using the N terminal of VIM corresponding to a region with amino acids LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
- Top Product
- Discover our top product VIM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Vimentin Blocking Peptide, catalog no. 33R-5218, is also available for use as a blocking control in assays to test for specificity of this Vimentin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Vimentin (VIM)
- Alternative Name
- Vimentin (VIM Products)
- Synonyms
- CTRCT30 antibody, cb28 antibody, vime antibody, vim antibody, vim1 antibody, vim2 antibody, VIM antibody, Vimentin antibody, vim4 antibody, vimentin antibody, vimentin L homeolog antibody, vimentin S homeolog antibody, VIM antibody, Vim antibody, vim antibody, vim.L antibody, vim.S antibody
- Background
- Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis
-