RAD17 antibody

Catalog No. ABIN631819

Product Details anti-RAD17 Antibody

Target: RAD17

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD17 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD17 Blocking Peptide, catalog no. 33R-6262, is also available for use as a blocking control in assays to test for specificity of this RAD17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD17

Target: RAD17

Alternative Name: RAD17 (RAD17 Products)

Synonyms: zgc:91969 antibody, RAD17 antibody, K2A18.21 antibody, K2A18_21 antibody, RADIATION SENSITIVE 17 antibody, CCYC antibody, HRAD17 antibody, R24L antibody, RAD17SP antibody, RAD24 antibody, 9430035O09Rik antibody, MmRad24 antibody, RAD17 checkpoint clamp loader component antibody, Rad17p antibody, RADIATION SENSITIVE 17 antibody, RAD17 antibody, rad17 antibody, ATRAD17 antibody, Rad17 antibody

Background: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs.

Molecular Weight: 76 kDa (MW of target protein)