PTGDS antibody
-
- Target See all PTGDS Antibodies
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTGDS antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- PTGDS antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS
- Top Product
- Discover our top product PTGDS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTGDS Blocking Peptide, catalog no. 33R-5773, is also available for use as a blocking control in assays to test for specificity of this PTGDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTGDS (Prostaglandin D2 Synthase (PTGDS))
- Alternative Name
- PTGDS (PTGDS Products)
- Synonyms
- 6PGD antibody, GSTS antibody, GSTS1-1 antibody, PGD2 antibody, PGDS antibody, L-PGDS antibody, LPGDS antibody, PDS antibody, PGDS2 antibody, H-PGDS antibody, Ptgds2 antibody, 21kDa antibody, Ptgs3 antibody, PH2DISO antibody, phosphogluconate dehydrogenase antibody, hematopoietic prostaglandin D synthase antibody, prostaglandin D2 synthase antibody, prostaglandin D2 synthase (brain) antibody, prostaglandin D synthase antibody, prostaglandin D2 synthase 21kDa (brain) antibody, PGD antibody, HPGDS antibody, PTGDS antibody, Hpgds antibody, Ptgds antibody, LOC100009453 antibody
- Background
- PTGDS is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation.
- Molecular Weight
- 21 kDa (MW of target protein)
-