POLD2 antibody
-
- Target See all POLD2 Antibodies
- POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- POLD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT
- Top Product
- Discover our top product POLD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLD2 Blocking Peptide, catalog no. 33R-5355, is also available for use as a blocking control in assays to test for specificity of this POLD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLD2 (Polymerase (DNA Directed), delta 2, Accessory Subunit (POLD2))
- Alternative Name
- POLD2 (POLD2 Products)
- Synonyms
- 50kDa antibody, p50 antibody, po1D2 antibody, cdc1 antibody, si:dz150f13.3 antibody, zgc:55633 antibody, zgc:77043 antibody, DNA polymerase delta 2, accessory subunit antibody, polymerase (DNA directed), delta 2, regulatory subunit antibody, polymerase (DNA directed), delta 2, accessory subunit L homeolog antibody, POLD2 antibody, Pold2 antibody, pold2.L antibody, pold2 antibody
- Background
- This protein is a DNA polymerase delta complex, it is involved in DNA replication and repair.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA
-