PLK1 antibody
-
- Target See all PLK1 Antibodies
- PLK1 (Polo-Like Kinase 1 (PLK1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
- Top Product
- Discover our top product PLK1 Primary Antibody
-
anti-Polo-Like Kinase 1 (PLK1) (AA 331-508) antibody
PLK1 Reactivity: Human, Mouse WB, ELISA, IHC, FACS Host: Mouse Monoclonal 3C11 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 1-603) antibodyPLK1 Reactivity: Human WB, ELISA, IF, IP, PLA Host: Mouse Monoclonal 2G12 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 1-603) antibodyPLK1 Reactivity: Human WB, ELISA, IF Host: Mouse Monoclonal 4G11 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reactivity: Human WB, IHC, IHC (p), IP, FACS Host: Mouse Monoclonal 5C1 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reactivity: Human WB, IHC, IHC (p), IP Host: Mouse Monoclonal 1D4 unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reactivity: Human, Dog WB, IHC, IHC (p), IP Host: Mouse Monoclonal 6C6 unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 304-603) antibodyPLK1 Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reactivity: Human WB Host: Rabbit Monoclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) (AA 205-214), (pThr210) antibodyPLK1 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Polo-Like Kinase 1 (PLK1) antibodyPLK1 Reactivity: Human, Dog, Monkey WB, IF, IP, FACS Host: Mouse Monoclonal 8C12 unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLK1 Blocking Peptide, catalog no. 33R-4619, is also available for use as a blocking control in assays to test for specificity of this PLK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLK1 (Polo-Like Kinase 1 (PLK1))
- Alternative Name
- PLK1 (PLK1 Products)
- Synonyms
- PLK antibody, STPK13 antibody, plk antibody, PLK-1 antibody, Plx1 antibody, stpk13 antibody, Plk antibody, cb525 antibody, cb636 antibody, ik:tdsubc_2d1 antibody, wu:fb37g11 antibody, wu:fb76g03 antibody, xx:tdsubc_2d1 antibody, polo like kinase 1 antibody, polo like kinase 1 S homeolog antibody, polo-like kinase 1 antibody, polo-like kinase 1 (Drosophila) antibody, Serine/threonine-protein kinase plk-1 antibody, PLK1 antibody, plk1.S antibody, plk1 antibody, Plk1 antibody, plk-1 antibody
- Background
- Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of APC/C inhibitors, and the regulation of mitotic exit and cytokinesis.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Cell Division Cycle, M Phase
-
