ERK1 antibody (Middle Region)

Catalog No. ABIN634146

Product Details anti-ERK1 Antibody

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAPK3 antibody was raised against the middle region of MAPK3

Purification: Affinity purified

Immunogen: MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAPK3 Blocking Peptide, catalog no. 33R-4858, is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERK1

Target: ERK1 (MAPK3) (Mitogen-Activated Protein Kinase 3 (MAPK3))

Alternative Name: MAPK3 (MAPK3 Products)

Synonyms: ERK-1 antibody, ERK1 antibody, ERT2 antibody, HS44KDAP antibody, HUMKER1A antibody, P44ERK1 antibody, P44MAPK antibody, PRKM3 antibody, p44-ERK1 antibody, p44-MAPK antibody, Erk-1 antibody, Erk1 antibody, Ert2 antibody, Esrk1 antibody, Mnk1 antibody, Mtap2k antibody, Prkm3 antibody, p44 antibody, p44erk1 antibody, p44mapk antibody, ERK3 antibody, ERK6 antibody, P38GAMMA antibody, PRKM12 antibody, SAPK-3 antibody, SAPK3 antibody, fi06b09 antibody, wu:fi06b09 antibody, zERK1 antibody, Tb08.10J17.940 antibody, MAPK1 antibody, MNK1 antibody, AW123708 antibody, Erk6 antibody, P38gamma antibody, Prkm12 antibody, Sapk3 antibody, ATMAPK3 antibody, ATMPK3 antibody, T6D9.4 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 3 antibody, mitogen-activated protein kinase 12 antibody, mitogen activated protein kinase 3 antibody, mitogen-activated serine/threonine-protein kinase antibody, MAPK3 antibody, Mapk3 antibody, MAPK12 antibody, mapk3 antibody, Tc00.1047053509475.10 antibody, Tb927.8.3550 antibody, Mapk12 antibody, CEK1 antibody, MPK3 antibody

Background: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: MAPK Signaling, RTK Signaling, Interferon-gamma Pathway, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Protein targeting to Nucleus, Toll-Like Receptors Cascades, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, VEGFR1 Specific Signals, S100 Proteins