CHEK1 antibody
-
- Target See all CHEK1 Antibodies
- CHEK1 (Checkpoint Kinase 1 (CHEK1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHEK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHEK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
- Top Product
- Discover our top product CHEK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHEK1 Blocking Peptide, catalog no. 33R-8312, is also available for use as a blocking control in assays to test for specificity of this CHEK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHEK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHEK1 (Checkpoint Kinase 1 (CHEK1))
- Alternative Name
- CHEK1 (CHEK1 Products)
- Synonyms
- An08g10320 antibody, AO090003000441 antibody, CHK1 antibody, chk1 antibody, C85740 antibody, Chk1 antibody, rad27 antibody, id:ibd2720 antibody, zgc:56093 antibody, CHEK1 antibody, checkpoint kinase 1 antibody, serine/threonine-protein kinase chk1 antibody, serine/threonine-protein kinase Chk1 antibody, CAMK/CAMKL/CHK1 protein kinase Chk1 antibody, checkpoint kinase 1 S homeolog antibody, CHEK1 antibody, ANI_1_2436074 antibody, AOR_1_768154 antibody, PTRG_04183 antibody, SJAG_01680 antibody, PAAG_04978 antibody, MCYG_03290 antibody, VDBG_03742 antibody, chek1.S antibody, Chek1 antibody, chek1 antibody
- Background
- CHEK1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage. Its expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- p53 Signaling, Apoptosis, Cell Division Cycle, DNA Damage Repair
-