IL-1 beta antibody (N-Term)
-
- Target See all IL-1 beta (IL1B) Antibodies
- IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL-1 beta antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL1 beta antibody was raised against the N terminal of IL1 B
- Purification
- Affinity purified
- Immunogen
- IL1 beta antibody was raised using the N terminal of IL1 B corresponding to a region with amino acids DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
- Top Product
- Discover our top product IL1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL1 beta Blocking Peptide, catalog no. 33R-2037, is also available for use as a blocking control in assays to test for specificity of this IL1 beta antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-1 beta (IL1B) (Interleukin 1, beta (IL1B))
- Alternative Name
- IL1 beta (IL1B Products)
- Synonyms
- IL-1 antibody, IL1-BETA antibody, IL1F2 antibody, IL-1BETA antibody, IL1beta antibody, il1-b antibody, zgc:111873 antibody, IL-1B antibody, IL-1beta antibody, Il-1b antibody, IL1B antibody, IL-1 beta antibody, IL-1b antibody, interleukin 1 beta antibody, interleukin 1, beta antibody, IL1B antibody, il1b antibody, Il1b antibody
- Background
- IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
- Molecular Weight
- 17 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, Interferon-gamma Pathway, TLR Signaling, Negative Regulation of Hormone Secretion, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Autophagy, Cancer Immune Checkpoints, Inflammasome
-