SPTLC1 antibody (Middle Region)

Catalog No. ABIN635128

Product Details anti-SPTLC1 Antibody

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPTLC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPTLC1 antibody was raised against the middle region of SPTLC1

Purification: Affinity purified

Immunogen: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPTLC1 Blocking Peptide, catalog no. 33R-2041, is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPTLC1

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Alternative Name: SPTLC1 (SPTLC1 Products)

Synonyms: ATSPT1 antibody, SERINE PALMITOYLTRANSFERASE 1 antibody, serine palmitoyltransferase 1 antibody, Afu6g00300 antibody, HSAN1 antibody, HSN1 antibody, LBC1 antibody, LCB1 antibody, SPT1 antibody, SPTI antibody, wu:fc75h04 antibody, wu:fp41c08 antibody, zgc:112247 antibody, AW552086 antibody, C77762 antibody, E030036H05 antibody, Lcb1 antibody, RGD1306617 antibody, Spt1 antibody, serine palmitoyltransferase 1 antibody, Serine palmitoyltransferase 1 antibody, serine palmitoyltransferase long chain base subunit 1 antibody, serine palmitoyltransferase, long chain base subunit 1 antibody, serine palmitoyltransferase, long chain base subunit 1 L homeolog antibody, SPT1 antibody, AFUA_6G00300 antibody, PAS_FragB_0040 antibody, SPTLC1 antibody, sptlc1 antibody, sptlc1.L antibody, Sptlc1 antibody

Background: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Molecular Weight: 53 kDa (MW of target protein)