anti-Mouse (Murine) Leptin antibody for Immunocytochemistry

Recommended Leptin Antibody (supplied by: Log in to see )

Antigen
Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
Reactivity
Human, Mouse (Murine), Rat (Rattus)
420
174
153
24
7
6
5
4
4
4
3
3
2
2
1
1
1
1
1
1
Host
Rabbit
372
209
19
8
4
1
Clonality
Polyclonal
Conjugate
This Leptin antibody is un-conjugated
64
26
17
14
10
7
7
7
6
5
4
4
4
4
4
4
4
4
4
4
4
3
3
3
3
3
3
3
3
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
410
403
107
56
55
39
31
30
28
26
17
13
10
6
5
4
4
3
3
3
2
2
2
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4892220
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN152764 ICC IHC IHC (fro) WB Rabbit IgG Log in to see Polyclonal
1 ABIN3201294 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 22-167 Log in to see
1 ABIN1078272 ICC IHC IP WB Rabbit IgG AA 22-167 Log in to see Polyclonal
1 ABIN2742564 ICC IHC (fro) WB Rabbit IgG AA 25-44 Log in to see Polyclonal
1 ABIN2742565 ICC IF WB Rabbit IgG AA 91-106 Log in to see Polyclonal
1 ABIN1862846 ICC IF IHC WB FITC Rabbit IgG Log in to see Polyclonal
1 ABIN5565627 FACS ICC IF IHC PE Rabbit Log in to see Polyclonal
1 ABIN5565624 FACS ICC IF IHC APC Rabbit Log in to see Polyclonal
1 ABIN5565625 FACS ICC IF IHC FITC Rabbit Log in to see Polyclonal

General

Antigen Leptin (LEP) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(420), (174), (153), (24), (7), (6), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(372), (209), (19), (8), (4), (1)
Clonality
Polyclonal
Conjugate This Leptin antibody is un-conjugated
(64), (26), (17), (14), (10), (7), (7), (7), (6), (5), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(410), (403), (107), (56), (55), (39), (31), (30), (28), (26), (17), (13), (10), (6), (5), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to LEP(leptin) The peptide sequence was selected from the middle region of LEP (NP_000221). Peptide sequence LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM.

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling Images back to top
Antigen
Alternative Name Leptin/OB (LEP Antibody Abstract)
Background Gene Symbol: LEP
Molecular Weight Theoretical MW: 16 kDa
Gene ID 3952
UniProt P41159
Pathways JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunohistochemistry 4-8 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 4-8 μg/mL, ImmunocytochemistryThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Leptin Antibody Target Details Leptin Application Details Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

Images

Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling back to top
Supplier Images
Simple Western (SimWes) image for anti-Leptin (LEP) antibody (ABIN4892220) Simple Western: Leptin/OB Antibody [NBP1-59324] - Simple Western analysis of Leptin. ...
Immunocytochemistry (ICC) image for anti-Leptin (LEP) antibody (ABIN4892220) Immunocytochemistry: Leptin/OB Antibody [NBP1-59324] - Rat and mouse brain, 10 ug/ml....
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leptin (LEP) antibody (ABIN4892220) Immunohistochemistry-Paraffin: Leptin/OB Antibody [NBP1-59324] - Human pancreas tissu...
Western Blotting (WB) image for anti-Leptin (LEP) antibody (ABIN4892220) Western Blot: Leptin/OB Antibody [NBP1-59324] - Titration: 0.2-1 ug/ml, Positive Cont...