You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CDT1 antibody for Immunofluorescence

Recommended CDT1 Antibody (supplied by: Log in to see )

Chromatin Licensing and DNA Replication Factor 1 (CDT1) Antibodies
  • CDT1
  • fc37h07
  • im:7158083
  • wu:fc37h07
  • wu:fi38h09
  • xcdt1
  • DUP
  • RIS2
  • 2610318F11Rik
  • AW545653
  • C76791
  • Ris2
  • dup
  • ris2
  • chromatin licensing and DNA replication factor 1
  • CDT1
  • cdt1
  • Cdt1
Human, Mouse (Murine), Rat (Rattus)
This CDT1 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4891821
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN251007 ICC IF IHC IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal 4
1 ABIN1977662 IF IP IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal
1 ABIN1977663 IF IHC (p) Rabbit IgG C-Term Log in to see Polyclonal

Top referenced anti-CDT1 antibody for Immunofluorescence

Similar anti-CDT1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 4 Antibodies 4 Antibodies 21 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 1 Antibodies 2 Antibodies
Immunofluorescence (IF) 1 Antibodies 1 Antibodies 4 Antibodies
Immunohistochemistry (IHC) 1 Antibodies 1 Antibodies 2 Antibodies
Western Blotting (WB) 8 Antibodies 8 Antibodies 37 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Immunoprecipitation (IP) 4 Antibodies


Antigen Chromatin Licensing and DNA Replication Factor 1 (CDT1) Antibodies
Epitope C-Term
(24), (2), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(40), (8), (8), (1)
Host Rabbit
(20), (18), (2)
Conjugate This CDT1 antibody is un-conjugated
(1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(36), (21), (4), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-CDT1 Antibody

Target Details CDT1 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to CDT1(chromatin licensing and DNA replication factor 1) The peptide sequence was selected from the C terminal of CDT1. Peptide sequence PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ.

Target Details CDT1

Product Details anti-CDT1 Antibody Application Details Handling Images back to top
Alternative Name CDT1 (CDT1 Antibody Abstract)
Background Gene Symbol: CDT1
Gene ID 81620
Research Area DNA/RNA, Transcription Factors, Chromatin and Nuclear Signaling
Pathways MAPK Signaling

Application Details

Product Details anti-CDT1 Antibody Target Details CDT1 Handling Images back to top
Application Notes Western Blot 0.2-1 μg/mL, Immunocytochemistry/Immunofluorescence 1:10-1:2000This is a rabbit polyclonal antibody against CDT1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CDT1 Antibody Target Details CDT1 Application Details Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.


Product Details anti-CDT1 Antibody Target Details CDT1 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-CDT1 antibody (Chromatin Licensing and DNA Replication Factor 1) (C-Term) (ABIN4891821) Immunocytochemistry/Immunofluorescence: CDT1 Antibody [NBP1-58114] - Mouse brain stem...
Western Blotting (WB) image for anti-CDT1 antibody (Chromatin Licensing and DNA Replication Factor 1) (C-Term) (ABIN4891821) Western Blot: CDT1 Antibody [NBP1-58114] - Sample Type: 3. rat brain extract (80ug) P...
Western Blotting (WB) image for anti-CDT1 antibody (Chromatin Licensing and DNA Replication Factor 1) (C-Term) (ABIN4891821) Western Blot: CDT1 Antibody [NBP1-58114] - Sample Type : 3. rat brain extract (80ug) ...