You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MAP1A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MAP1A Antibody (supplied by: Log in to see )

Microtubule-Associated Protein 1A (MAP1A) Antibodies
  • 6330416M19Rik
  • AI853608
  • DKFZp468P0224
  • Dmel\\CG13630
  • F4L23.25
  • MAP1A
  • MAP1L
  • methionine aminopeptidase 1A
  • moth1
  • Mtap-1
  • Mtap1
  • MTAP1A
  • Mtap1a
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332589
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008917009 ABIN735308 IF (p) IHC (p) Rabbit IgG AA 2475-2520 Log in to see Polyclonal
0.0008917009 ABIN4332590 IHC IHC (p) Rabbit IgG Log in to see Polyclonal

Similar anti-MAP1A Antibodies

Application / Reactivity Human
ELISA 2 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 3 Antibodies
Immunoprecipitation (IP) 4 Antibodies


Antigen Microtubule-Associated Protein 1A (MAP1A) Antibodies
Reactivity Human
(10), (7), (6)
Host Rabbit
(10), (5)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(7), (7), (6), (5), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-MAP1A Antibody

Target Details MAP1A Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SSFSHSTPSGNGKYLPGAITSPDEHILTPDSSFSKSPESLPGPALEDIAIKWEDKVPGLKDRTSEQKKEPEPKDEVLQQKD
Isotype IgG

Target Details MAP1A

Product Details anti-MAP1A Antibody Application Details Handling Images back to top
Alternative Name MAP1A (MAP1A Antibody Abstract)
Background Gene Symbol: MAP1A
Pathways Microtubule Dynamics

Application Details

Product Details anti-MAP1A Antibody Target Details MAP1A Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-MAP1A Antibody Target Details MAP1A Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-MAP1A Antibody Target Details MAP1A Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MAP1A antibody (Microtubule-Associated Protein 1A) (ABIN4332589) Immunohistochemistry-Paraffin: MAP1A Antibody [NBP1-82801] - Staining of human cerebe...
Immunofluorescence (IF) image for anti-MAP1A antibody (Microtubule-Associated Protein 1A) (ABIN4332589) Immunocytochemistry/Immunofluorescence: MAP1A Antibody [NBP1-82801] - Staining of hum...