You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human RYK antibody for Immunocytochemistry

Recommended RYK Antibody (supplied by: Log in to see )

Antigen
RYK Receptor-Like Tyrosine Kinase (RYK) Antibodies
  • AW536699
  • D3S3195
  • d3s3195
  • ERK-3
  • JTK5
  • jtk5
  • JTK5A
  • jtk5a
  • MGC114645
  • RYK
  • ryk1
  • RYK1
  • Vik
  • wu:fb37b12
  • wu:fi05b06
  • zgc:158381
Reactivity
Human
93
20
9
1
1
1
Host
Rabbit
66
23
10
3
Clonality
Polyclonal
Conjugate
This RYK antibody is un-conjugated
9
9
8
8
8
8
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
91
68
30
6
3
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN4351516
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0009965416 ABIN3060809 ICC IF IHC WB Rabbit Log in to see Polyclonal

Similar anti-RYK Antibodies

Application / Reactivity Human
ELISA 62 Antibodies
Enzyme Immunoassay (EIA) 3 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunohistochemistry (IHC) 31 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies
Western Blotting (WB) 85 Antibodies

General

Antigen RYK Receptor-Like Tyrosine Kinase (RYK) Antibodies
Reactivity Human
(93), (20), (9), (1), (1), (1)
Host Rabbit
(66), (23), (10), (3)
Clonality
Polyclonal
Conjugate This RYK antibody is un-conjugated
(9), (9), (8), (8), (8), (8)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(91), (68), (30), (6), (3), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-RYK Antibody

Target Details RYK Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSSLGYPTLRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITH

Target Details RYK

Product Details anti-RYK Antibody Application Details Handling Images back to top
Antigen
Alternative Name Ryk (RYK Antibody Abstract)
Background Gene Symbol: RYK
UniProt P34925
Pathways RTK Signaling, WNT Signaling

Application Details

Product Details anti-RYK Antibody Target Details RYK Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RYK Antibody Target Details RYK Application Details Images back to top
Format Liquid
Buffer PBS and 40 % glycerol ( pH 7.2)
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.