BSCL2 antibody (Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin)) (AA 259-357)

Details for Product anti-BSCL2 Antibody No. ABIN1327202
Antigen
Epitope
AA 259-357
9
9
8
3
2
2
2
1
1
1
1
Reactivity
Human
32
3
3
2
2
2
1
1
1
Host
Mouse
27
5
1
Clonality (Clone)
Monoclonal ()
Conjugate
This BSCL2 antibody is un-conjugated
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
33
21
19
2
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant BSCL2.
Immunogen

immunogen: BSCL2 (NP_116056, 259 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: WGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAAL

Clone 1G4
Isotype IgG1 kappa
Cross-Reactivity Human
Antigen
Alternative Name BSCL2 (BSCL2 Antibody Abstract)
Background Full Gene Name: Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Synonyms: GNG3LG,HMN5,MGC4694,SPG17
Gene ID 26580
NCBI Accession NP_116056, NM_032667
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin) (BSCL2) (AA 259-357) antibody (ABIN1327202) Detection limit for recombinant GST tagged BSCL2 is approximately 0.1ng/ml as a captu...
Image no. 2 for anti-Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin) (BSCL2) (AA 259-357) antibody (ABIN1327202) Western Blot detection against Immunogen (36.63 KDa) .