BSCL2 antibody (Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin)) (AA 263-354)

Details for Product anti-BSCL2 Antibody No. ABIN1327730
Antigen
Epitope
AA 263-354
9
9
8
3
2
2
2
2
1
1
Reactivity
Human
32
3
3
2
2
2
1
1
1
Host
Mouse
27
5
1
Clonality
Polyclonal
Conjugate
This BSCL2 antibody is un-conjugated
2
2
2
2
2
2
Application
ELISA, Western Blotting (WB)
33
21
19
2
1
1
Options
Purpose Mouse polyclonal antibody raised against a partial recombinant BSCL2.
Immunogen

immunogen: BSCL2 (NP_116056, 263 a.a. ~ 354 a.a) partial recombinant protein with GST tag.

Immunogen Sequence: WPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWED

Cross-Reactivity Human
Antigen
Alternative Name BSCL2 (BSCL2 Antibody Abstract)
Background Full Gene Name: Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Synonyms: GNG3LG,HMN5,MGC4694,SPG17
Gene ID 26580
NCBI Accession NP_116056, NM_032667
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin) (BSCL2) (AA 263-354) antibody (ABIN1327730) Western Blot analysis of BSCL2 expression in transfected 293T cell line by BSCL2 poly...
Image no. 2 for anti-Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin) (BSCL2) (AA 263-354) antibody (ABIN1327730) BSCL2 polyclonal antibody (A02). Western Blot analysis of BSCL2 expression in Jurkat.
Image no. 3 for anti-Berardinelli-Seip Congenital Lipodystrophy 2 (Seipin) (BSCL2) (AA 263-354) antibody (ABIN1327730) Western Blot detection against Immunogen (36.23 KDa) .
Product cited in: Liu, Jiang, Wang, Zhang, Lin, Lam, Shui, Zhou, Li, Wang, Cui, Gao, Zhang, Lv, Xu, Liu, Zhao, Yang: "Adipose-specific knockout of SEIPIN/BSCL2 results in progressive lipodystrophy." in: Diabetes, Vol. 63, Issue 7, pp. 2320-31, 2014 (PubMed).

Cui, Wang, Meng, Fei, Deng, Xu, Peng, Ju, Zhang, Liu, Zhao, Yang: "Overexpression of a short human seipin/BSCL2 isoform in mouse adipose tissue results in mild lipodystrophy." in: American journal of physiology. Endocrinology and metabolism, Vol. 302, Issue 6, pp. E705-13, 2012 (PubMed).