HIV-1 Transmembrane Glycoprotein (HIV-1 gp41) (AA 502-541) antibody
-
- Target
- HIV-1 Transmembrane Glycoprotein (HIV-1 gp41)
-
Binding Specificity
- AA 502-541
- Reactivity
- Human Immunodeficiency Virus (HIV), Human, Virus
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB), ELISA
- Specificity
- Recognizes gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.
- Purification
- Purified
- Immunogen
-
Synthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR.
Type of Immunogen: Synthetic peptide - Isotype
- IgG
-
-
- Application Notes
- Approved: ELISA (1:50 - 1:500), WB (1:50 - 1:500)
- Comment
-
Target Species of Antibody: Human Immunodeficiency Virus
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 150 mM sodium chloride Ph 6.0-7.0, 0.09 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- 4°C or -20°C, Avoid freeze-thaw cycles.
-
- Target
- HIV-1 Transmembrane Glycoprotein (HIV-1 gp41)
- Alternative Name
- HIV-1 Gp41
- Target Type
- Viral Protein
-