ENO2/NSE antibody (AA 2-285)
-
- Target See all ENO2/NSE (ENO2) Antibodies
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
-
Binding Specificity
- AA 2-285
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ENO2/NSE antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Purpose
- Polyclonal Antibody to Enolase, Neuron Specific (NSE)
- Specificity
- The antibody is a rabbit polyclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.
- Cross-Reactivity
- Mouse, Rat
- Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogen
- Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag
- Isotype
- IgG
- Top Product
- Discover our top product ENO2 Primary Antibody
-
-
- Application Notes
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Comment
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Preservative
- ProClin
- Precaution of Use
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Handling Advice
- Avoid repeated freeze-thaw cycles.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Expiry Date
- 24 months
-
- Target
- ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))
- Alternative Name
- Enolase, Neuron Specific (ENO2 Products)
- Synonyms
- ENO2 antibody, DKFZp459B1817 antibody, NSE antibody, AI837106 antibody, D6Ertd375e antibody, Eno-2 antibody, RNEN3 antibody, eno3 antibody, wu:fc09h05 antibody, zgc:92418 antibody, enolase 2 antibody, enolase 2 (gamma, neuronal) antibody, enolase 2, gamma neuronal antibody, enolase 2, gamma, neuronal antibody, ENO2 antibody, Eno2 antibody, eno2 antibody
- Background
- ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
-