IL-21 antibody (N-Term)

Catalog No. ABIN2288617

This Goat Polyclonal antibody specifically detects IL-21 in ELISA and IC. It exhibits reactivity toward Human.

Quick Overview for IL-21 antibody (N-Term) (ABIN2288617)

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This IL-21 antibody is un-conjugated

Application: ELISA, Immunochromatography (IC)

Product Details anti-IL-21 Antibody

Binding Specificity: N-Term

Sequence: CRQLIDIVDQ LKNYVNDLVP EFLPAPEDVE

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Interleukin 21 (IL-21), NT

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide CRQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to N-terminus of human IL-21.

Isotype: IgG

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for IL-21

Target: IL-21 (IL21) (Interleukin 21 (IL21))

Alternative Name: Interleukin 21

Pathways: JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response