MMP3 antibody (AA 410-439)

Catalog No. ABIN2742989

Product Details anti-MMP3 Antibody

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Binding Specificity: AA 410-439

Reactivity: Human, Gibbon

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for MMP3

Target: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Alternative Name: MMP3 (MMP3 Products)

Synonyms: CHDS6 antibody, MMP-3 antibody, SL-1 antibody, STMY antibody, STMY1 antibody, STR1 antibody, SLN-1 antibody, SLN1 antibody, STR-1 antibody, Stmy1 antibody, Str1 antibody, MMP10 antibody, chds6 antibody, mmp-3 antibody, mmp13 antibody, mmp3 antibody, sl-1 antibody, stmy antibody, stmy1 antibody, str1 antibody, matrix metallopeptidase 3 antibody, matrix metallopeptidase 3 (stromelysin 1, progelatinase) antibody, matrix metallopeptidase 3 L homeolog antibody, MMP3 antibody, Mmp3 antibody, mmp3.L antibody

Background: Name/Gene ID: MMP3
Subfamily: Metallopeptidase M10A
Family: Protease

Synonyms: MMP3, CHDS6, MMP-3, Prostromelysin-1, Proteoglycanase, SL-1, STR1, Matrix metalloproteinase-3, Transin, Transin-1, SLN-1, STMY, Progelatinase, STMY1, Stromelysin-1

Gene ID: 4314