STAT6 antibody (AA 85-115)

Catalog No. ABIN2744567

Product Details anti-STAT6 Antibody

Target: STAT6 (Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6))

Binding Specificity: AA 85-115

Reactivity: Human, Rat, Dog, Bat, Chimpanzee

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAT6 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for STAT6

Target: STAT6 (Signal Transducer and Activator of Transcription 6, Interleukin-4 Induced (STAT6))

Alternative Name: STAT6 (STAT6 Products)

Synonyms: D12S1644 antibody, IL-4-STAT antibody, STAT6B antibody, STAT6C antibody, signal transducer and activator of transcription 6 antibody, signal transducer and activator of transcription 6-like antibody, STAT6 antibody, Stat6 antibody, LOC100859543 antibody

Background: Name/Gene ID: STAT6

Synonyms: STAT6, D12S1644, IL-4-STAT, Stat-6, STAT6B, STAT6C, STAT, interleukin4-induced, IL-4 Stat, Transcription factor IL-4 STAT

Gene ID: 6778

Pathways: JAK-STAT Signaling, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response