BMI1 antibody (Middle Region)

Catalog No. ABIN3030170

Product Details anti-BMI1 Antibody

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMI1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Bmi1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for BMI1

Target: BMI1 (BMI1 Polycomb Ring Finger Oncogene (BMI1))

Alternative Name: Bmi1 (BMI1 Products)

Synonyms: FLVI2/BMI1 antibody, PCGF4 antibody, RNF51 antibody, AW546694 antibody, Bmi-1 antibody, Pcgf4 antibody, bmi1 antibody, pcgf4 antibody, psc1 antibody, wu:fb17g03 antibody, wu:fd18f06 antibody, BMI-1 antibody, pcgf4b antibody, bmi-1 antibody, bmi1-a antibody, bmi1-b antibody, bmi1b antibody, rnf51 antibody, xbmi-1 antibody, BMI1 proto-oncogene, polycomb ring finger antibody, BMI1 polycomb ring finger oncogene antibody, Bmi1 polycomb ring finger oncogene antibody, bmi1 polycomb ring finger oncogene 1a antibody, bmi1 polycomb ring finger oncogene 1b antibody, BMI1 proto-oncogene, polycomb ring finger L homeolog antibody, BMI1 antibody, LOC100230513 antibody, Bmi1 antibody, bmi1a antibody, bmi1b antibody, bmi1.L antibody

Background: B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human gene is assigned to chromosome 10p13. It has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that the protein completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells.

Gene ID: 648

Pathways: Cell Division Cycle, Autophagy