NPY antibody (Middle Region)

Catalog No. ABIN3031979

Product Details anti-NPY Antibody

Target: NPY (Neuropeptide Y (NPY))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPY antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) was used as the immunogen for this NPY antibody (100% homologous in human, mouse and rat).

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the NPY antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NPY antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NPY

Target: NPY (Neuropeptide Y (NPY))

Alternative Name: NPY Neuropeptide Y (NPY Products)

Synonyms: 0710005A05Rik antibody, PYY4 antibody, NPY02 antibody, RATNPY antibody, RATNPY02 antibody, si:dkey-22m8.5 antibody, npy antibody, npyb antibody, preproNPY antibody, pyy4 antibody, xnpy antibody, npya antibody, MGC86288 antibody, prepronpy antibody, NPY antibody, NPY1 antibody, neuropeptide Y antibody, neuropeptide Y S homeolog antibody, neuropeptide Y L homeolog antibody, Npy antibody, NPY antibody, npy antibody, npy.S antibody, npy.L antibody, LOC100533423 antibody

Background: Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi.

Gene ID: 4852

Pathways: Feeding Behaviour