PAR1 antibody (N-Term)

Catalog No. ABIN3042380

Product Details anti-PAR1 Antibody

Target: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Binding Specificity: AA 46-82, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAR1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.

Sequence: RNPNDKYEPF WEDEEKNESG LTEYRLVSIN KSSPLQK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.
Gene Name: coagulation factor II (thrombin) receptor
Protein Name: Proteinase-activated receptor 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PAR1

Target: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Alternative Name: F2R (F2R Products)

Synonyms: CF2R antibody, HTR antibody, PAR-1 antibody, PAR1 antibody, TR antibody, Par1 antibody, TRGPC antibody, AI482343 antibody, Cf2r antibody, ThrR antibody, Par-1 antibody, f2r-a antibody, par1 antibody, coagulation factor II thrombin receptor antibody, coagulation factor II (thrombin) receptor antibody, coagulation factor 2 (thrombin) receptor L homeolog antibody, F2R antibody, F2r antibody, f2r.L antibody

Background: Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.

Synonyms: CF2R antibody|Coagulation factor II (thrombin) receptor antibody|Coagulation factor II receptor antibody|F2R antibody|HTR antibody|PAR 1 antibody|PAR-1 antibody|PAR1 antibody|PAR1_HUMAN antibody|Protease activated receptor 1 antibody|Proteinase activated receptor 1 antibody|Proteinase-activated receptor 1 antibody|Thrombin receptor antibody|TR antibody

Gene ID: 2149

UniProt: P25116

Pathways: Nuclear Receptor Transcription Pathway, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus