HDAC6 antibody (N-Term)
-
- Target See all HDAC6 Antibodies
- HDAC6 (Histone Deacetylase 6 (HDAC6))
-
Binding Specificity
- AA 137-169, N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HDAC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.
- Sequence
- EKEELMLVHS LEYIDLMETT QYMNEGELRV LAD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.
Gene Name: histone deacetylase 6
Protein Name: Histone deacetylase 6 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product HDAC6 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HDAC6 (Histone Deacetylase 6 (HDAC6))
- Alternative Name
- HDAC6 (HDAC6 Products)
- Synonyms
- HD6 antibody, Hd6 antibody, Hdac5 antibody, Sfc6 antibody, mHDA2 antibody, CG6170 antibody, DHDAC2 antibody, DmHDAC2 antibody, Dmel\\CG6170 antibody, HDAC antibody, HDAC2 antibody, dHDAC2 antibody, dHDAC6 antibody, dmHDA404 antibody, hdac6 antibody, MGC53140 antibody, wu:fc31d02 antibody, dsim_GLEANR_17355 antibody, DsimGD17207 antibody, GD17207 antibody, HDAC6 antibody, ATHDA6 antibody, AXE1 antibody, HISTONE DEACETYLASE 6 antibody, MDC12.7 antibody, MDC12_7 antibody, RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1 antibody, RPD3B antibody, RTS1 antibody, SIL1 antibody, histone deacetylase 6 antibody, histone deacetylase 6 antibody, Histone deacetylase 6 antibody, histone deacetylase 6 L homeolog antibody, GD17207 gene product from transcript GD17207-RB antibody, Histone DeAcetylase antibody, HDAC6 antibody, Hdac6 antibody, hdac6.L antibody, hdac6 antibody, Dsim\HDAC6 antibody, PTRG_03035 antibody, HDA6 antibody, hda-6 antibody
- Background
-
HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.
Synonyms: FLJ16239 antibody|HD 6 antibody|HD6 antibody|HDAC 6 antibody|HDAC6 antibody|HDAC6_HUMAN antibody|Histone deacetylase 6 (HD6) antibody| Histone deacetylase 6 antibody|JM 21 antibody|JM21 antibody|KIAA0901 antibody|OTTHUMP00000032398 antibody|OTTHUMP00000197663 antibody - Gene ID
- 10013
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-