HSP90AB1 antibody (C-Term)

Catalog No. ABIN3042462

Product Details anti-HSP90AB1 Antibody

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Binding Specificity: AA 449-481, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP90AB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RRLSELLRYH TSQSGDEMTS LSEYVSRMKE TQK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock protein 90 kDa alpha (cytosolic), class B member 1
Protein Name: Heat shock protein HSP 90-beta

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HSP90AB1

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Alternative Name: HSP90AB1 (HSP90AB1 Products)

Synonyms: D6S182 antibody, HSP84 antibody, HSP90B antibody, HSPC2 antibody, HSPCB antibody, GRP94 antibody, TRA1 antibody, hsp90b antibody, 90kDa antibody, AL022974 antibody, C81438 antibody, Hsp84 antibody, Hsp84-1 antibody, Hsp90 antibody, Hspcb antibody, Hsp70 antibody, Hsp70-1 antibody, Hsp70.1 antibody, hsp68 antibody, HSP90-BETA antibody, hsp90beta antibody, wu:fa29f01 antibody, wu:fa91e11 antibody, wu:fd59e11 antibody, wu:gcd22h07 antibody, HSP90 antibody, heat shock protein 90 alpha family class B member 1 antibody, heat shock protein 90 beta family member 1 antibody, Heat Shock Protein 90, endoplasmic reticulum antibody, heat shock protein 90B antibody, heat shock protein 90 alpha (cytosolic), class B member 1 antibody, heat shock protein 1B antibody, heat shock protein 90kDa alpha family class B member 1 S homeolog antibody, heat shock protein 90, alpha (cytosolic), class B member 1 antibody, HSP90AB1 antibody, HSP90B1 antibody, HSP90B antibody, hsp90ab1 antibody, Hsp90ab1 antibody, Hspa1b antibody, hsp90ab1.S antibody

Background: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

Synonyms: 90 kda heat shock protein beta HSP90 beta antibody|D6S182 antibody|FLJ26984 antibody|Heat shock 84 kDa antibody|Heat shock 90kD protein 1, beta antibody|Heat shock 90 kDa protein 1 beta antibody|Heat shock protein 90 kDa alpha (cytosolic) class B member 1 antibody|Heat shock protein beta antibody|Heat shock protein HSP 90 beta antibody|Heat shock protein HSP 90-beta antibody|HS90B_HUMAN antibody|HSP 84 antibody|HSP 90 antibody|HSP 90 b antibody|HSP 90b antibody|HSP84 antibody|HSP90 BETA antibody|hsp90ab1 antibody| HSP90B antibody|HSPC2 antibody|HSPCB antibody

Gene ID: 3326

UniProt: P08238

Pathways: Regulation of Cell Size