SMAD1/2/3/4/5 (AA 240-270), (Middle Region) antibody
Reactivity: Human, Mouse, Rat
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
(5 references)-
- Target
- SMAD1/2/3/4/5
- Binding Specificity
- AA 240-270, Middle Region
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Mothers against decapentaplegic homolog 1(SMAD1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- QPMDTNMMAP PLPSEINRGD VQAVAYEEPK H
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Mothers against decapentaplegic homolog 1(SMAD1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: SMAD family member 1
Protein Name: Mothers against decapentaplegic homolog 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
- Isotype
- IgG
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat , The detection limit for SMAD1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
: "NLRC5 Mediates IL-6 and IL-1? Secretion in LX-2 Cells and Modulated by the NF-?B/Smad3 Pathway." in: Inflammation, Vol. 38, Issue 5, pp. 1794-804, (2015) (PubMed).
: "Quercetin prevents ethanol-induced iron overload by regulating hepcidin through the BMP6/SMAD4 signaling pathway." in: The Journal of nutritional biochemistry, Vol. 25, Issue 6, pp. 675-82, (2014) (PubMed).
: "Dexamethasone attenuates bleomycin-induced lung fibrosis in mice through TGF-?, Smad3 and JAK-STAT pathway." in: International journal of clinical and experimental medicine, Vol. 7, Issue 9, pp. 2645-50, (2014) (PubMed).
: "Effects of huogu I formula (I) on correlated factors of bone regeneration in chickens with steroid-induced necrosis of femoral head." in: Chinese journal of integrative medicine, Vol. 18, Issue 5, pp. 378-84, (2012) (PubMed).
: "Tranilast prevents the progression of chronic cyclosporine nephrotoxicity through regulation of transforming growth factor ?/Smad pathways." in: Transplantation proceedings, Vol. 43, Issue 5, pp. 1985-8, (2011) (PubMed).
-
: "NLRC5 Mediates IL-6 and IL-1? Secretion in LX-2 Cells and Modulated by the NF-?B/Smad3 Pathway." in: Inflammation, Vol. 38, Issue 5, pp. 1794-804, (2015) (PubMed).
-
- Target
- SMAD1/2/3/4/5
- Background
-
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
Synonyms: BSP 1 | BSP1 | BSP-1 | BSP1 | MADH1 | MADR1 | HsMAD1 | JV4 1 | JV4-1 | MADH1 | Madh1 | Madr1 | Q15797 | SMAD1 - Gene ID
- 4086
- UniProt
- Q15797
-
You are here:
