Stathmin 1 antibody (N-Term)

Catalog No. ABIN3043301

Product Details anti-Stathmin 1 Antibody

Target: Stathmin 1 (STMN1)

Binding Specificity: AA 2-34, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Stathmin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: ASSDIQVKEL EKRASGQAFE LILSPRSKES VPE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: stathmin 1
Protein Name: Stathmin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Stathmin 1

Target: Stathmin 1 (STMN1)

Alternative Name: STMN1 (STMN1 Products)

Synonyms: C1orf215 antibody, LAP18 antibody, Lag antibody, OP18 antibody, PP17 antibody, PP19 antibody, PR22 antibody, SMN antibody, 19k antibody, Lap18 antibody, Op18 antibody, P18 antibody, P19 antibody, Pig antibody, Pp17 antibody, Pp18 antibody, Pp19 antibody, Pr22 antibody, Smn antibody, prosolin antibody, op18 antibody, stathmin antibody, stmn1 antibody, stmn1a antibody, lag antibody, lap18 antibody, pp17 antibody, pp19 antibody, pr22 antibody, smn antibody, fj43c10 antibody, wu:fj38b07 antibody, wu:fj43c10 antibody, zgc:110159 antibody, cb959 antibody, wu:fb14e04 antibody, zgc:136942 antibody, stmn1-a antibody, stmn1b antibody, xo35 antibody, stathmin 1 antibody, stathmin 1 S homeolog antibody, stathmin 1b antibody, stathmin 1a antibody, stathmin-like antibody, stathmin antibody, stathmin 1 L homeolog antibody, STMN1 antibody, Stmn1 antibody, stmn1.S antibody, stmn1 antibody, stmn1b antibody, stmn1a antibody, LOC100229194 antibody, stmn1.L antibody

Background: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: C1orf215 antibody|Lag antibody|LAP 18 antibody|LAP18 antibody|Leukemia associated phosphoprotein p18 antibody|Leukemia-associated phosphoprotein p18 antibody|Metablastin antibody|Oncoprotein 18 antibody|OP 18 antibody|OP18 antibody|p18 antibody|p19 antibody| Phosphoprotein 19 antibody|Phosphoprotein p19 antibody|PP17 antibody|PP19 antibody|PR22 antibody|Pr22 protein antibody|Prosolin antibody|Protein Pr22 antibody|SMN antibody| Stathmin antibody|Stathmin1 antibody|STMN 1 antibody|STMN1 antibody|STMN1_HUMAN antibody

Gene ID: 3925

UniProt: P16949

Pathways: MAPK Signaling, Microtubule Dynamics