PRKAB1 antibody (N-Term)
-
- Target See all PRKAB1 Antibodies
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
-
Binding Specificity
- AA 32-68, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKAB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.
- Sequence
- DRPKILMDSP EDADLFHSEE IKAPEKEEFL AWQHDLE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.
Gene Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PRKAB1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
- Alternative Name
- PRKAB1 (PRKAB1 Products)
- Synonyms
- AMPK antibody, HAMPKb antibody, 1300015D22Rik antibody, AU021155 antibody, E430008F22 antibody, MGC82489 antibody, prkab1 antibody, wu:fk93d05 antibody, wu:fw87e09 antibody, zgc:56652 antibody, zgc:76975 antibody, zgc:92228 antibody, protein kinase AMP-activated non-catalytic subunit beta 1 antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antibody, PRKAB1 antibody, Prkab1 antibody, prkab1.S antibody, prkab1 antibody, prkab1b antibody, prkab1a antibody
- Background
-
5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Synonyms: 1300015D22Rik antibody|5''-AMP-activated protein kinase subunit beta-1 antibody|AAKB1_HUMAN antibody|AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1 antibody|AMP-activated, noncatalytic, beta-1 antibody|AMPK antibody|AMPK beta 1 chain antibody|AMPK subunit beta-1 antibody|AMPK-BETA-1 antibody|AMPKb antibody|AU021155 antibody|E430008F22 antibody| HAMPKb antibody|MGC17785 antibody|PRKAB1 antibody - Gene ID
- 5564
- UniProt
- Q9Y478
- Pathways
- AMPK Signaling, Warburg Effect
-