ARC (AA 332-366), (C-Term) antibody

Catalog No. ABIN3043525

Product Details

Target: ARC

Binding Specificity: AA 332-366, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.

Sequence: KLKRFLRHPL PKTLEQLIQR GMEVQDDLEQ AAEPA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: activity-regulated cytoskeleton-associated protein
Protein Name: Activity-regulated cytoskeleton-associated protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details

Target: ARC

Synonyms: activity regulated cytoskeleton associated protein antibody, Arc antibody

Background: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Synonyms: activity regulated cytoskeleton associated protein antibody|activity regulated gene 3.1 protein homolog antibody|Activity-regulated cytoskeleton-associated protein antibody|Activity-regulated gene 3.1 protein homolog antibody|Arc antibody|ARC/ARG3.1 antibody| ARC_HUMAN antibody|Arg3.1 antibody

Gene ID: 23237