JNK2 antibody (Middle Region)

Catalog No. ABIN3043612

Product Details anti-JNK2 Antibody

Target: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Binding Specificity: AA 257-288, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JNK2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.

Sequence: RNYVENRPKY PGIKFEELFP DWIFPSESER DK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.
Gene Name: mitogen-activated protein kinase 9
Protein Name: Mitogen-activated protein kinase 9

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for JNK2

Target: JNK2 (MAPK9) (Mitogen-Activated Protein Kinase 9 (MAPK9))

Alternative Name: MAPK9 (MAPK9 Products)

Synonyms: MAPK9 antibody, JNK-55 antibody, JNK2 antibody, JNK2A antibody, JNK2ALPHA antibody, JNK2B antibody, JNK2BETA antibody, PRKM9 antibody, SAPK antibody, SAPK1a antibody, p54a antibody, p54aSAPK antibody, AI851083 antibody, Prkm9 antibody, JNK2-ALPHA1 antibody, MAP kinase 9 antibody, mitogen-activated protein kinase 9 antibody, MAP kinase 9 antibody, MAPK9 antibody, Mapk9 antibody, MPK9 antibody

Background: JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Synonyms: c Jun kinase 2 antibody|C Jun N terminal kinase 2 antibody|c-Jun N-terminal kinase 2 antibody|JNK 55 antibody|JNK-55 antibody|JNK2 alpha antibody|JNK2 antibody|JNK2 beta antibody|JNK2A antibody|JNK2alpha antibody|JNK2B antibody|JNK2BETA antibody|Jun kinase antibody|MAP kinase 9 antibody|MAPK 9 antibody|Mapk9 antibody|Mitogen activated protein kinase 9 antibody|Mitogen-activated protein kinase 9 antibody|MK09_HUMAN antibody|P54a antibody|p54aSAPK antibody|PRKM9 antibody|SAPK alpha antibody|SAPK antibody|SAPK1a antibody|Stress activated protein kinase 1a antibody|Stress-activated protein kinase JNK2 antibody

Gene ID: 5601

UniProt: P45984

Pathways: MAPK Signaling, WNT Signaling, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, Toll-Like Receptors Cascades, BCR Signaling, S100 Proteins