Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GRP78 antibody (C-Term)

HSPA5 Reactivity: Human, Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043851
  • Target See all GRP78 (HSPA5) Antibodies
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Binding Specificity
    • 26
    • 16
    • 13
    • 8
    • 7
    • 6
    • 6
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 592-624, C-Term
    Reactivity
    • 185
    • 123
    • 106
    • 39
    • 38
    • 36
    • 34
    • 32
    • 31
    • 20
    • 15
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Rat, Mouse
    Host
    • 131
    • 89
    • 9
    • 3
    • 1
    • 1
    Rabbit
    Clonality
    • 134
    • 101
    Polyclonal
    Conjugate
    • 100
    • 21
    • 17
    • 14
    • 13
    • 12
    • 9
    • 8
    • 8
    • 8
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This GRP78 antibody is un-conjugated
    Application
    • 220
    • 104
    • 87
    • 85
    • 76
    • 34
    • 31
    • 28
    • 26
    • 21
    • 13
    • 7
    • 6
    • 3
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    ETMEKAVEEK IEWLESHQDA DIEDFKAKKK ELE
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for 78 kDa glucose-regulated protein(HSPA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: heat shock 70 kDa protein 5 (glucose-regulated protein, 78 kDa)
    Protein Name: 78 kDa glucose-regulated protein
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HSPA5 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Wang, Wang, Huang, Yang, Zhao, Wei, Zhao: "Erratum to: Ibutilide protects against cardiomyocytes injury via inhibiting endoplasmic reticulum and mitochondrial stress pathways." in: Heart and vessels, Vol. 32, Issue 2, pp. 216, (2016) (PubMed).

    Wu, Dong, Li: "Effects of miRNA-455 on cardiac hypertrophy induced by pressure overload." in: International journal of molecular medicine, Vol. 35, Issue 4, pp. 893-900, (2015) (PubMed).

    Li, Zhao, Xing, Sun: "Ulinastatin suppresses endoplasmic reticulum stress and apoptosis in the hippocampus of rats with acute paraquat poisoning." in: Neural regeneration research, Vol. 10, Issue 3, pp. 467-72, (2015) (PubMed).

    Ding, Zou, Li, Tian, Abdelalim, Du, She, Wang, Tan, Wang, Chen, Lv, Chang: "Study of histopathological and molecular changes of rat kidney under simulated weightlessness and resistance training protective effect." in: PLoS ONE, Vol. 6, Issue 5, pp. e20008, (2011) (PubMed).

  • Target
    GRP78 (HSPA5) (Heat Shock 70kDa Protein 5 (Glucose-Regulated Protein, 78kDa) (HSPA5))
    Alternative Name
    HSPA5 (HSPA5 Products)
    Synonyms
    GRP78 antibody, BiP antibody, GRP-78 antibody, grp78 antibody, hspa5a antibody, BIP antibody, MIF2 antibody, AL022860 antibody, AU019543 antibody, Bip antibody, D2Wsu141e antibody, D2Wsu17e antibody, Grp78 antibody, Hsce70 antibody, SEZ-7 antibody, Sez7 antibody, baffled antibody, mBiP antibody, cb865 antibody, fb60h09 antibody, fi36d04 antibody, wu:fb60h09 antibody, wu:fi36d04 antibody, zgc:55994 antibody, zgc:77606 antibody, 78 kDa glucose-regulated protein antibody, heat shock protein family A (Hsp70) member 5 antibody, BiP/GRP78 antibody, glucose-regulated protein 78 antibody, putative glucose-regulated protein 78 antibody, Hsp70 family ATPase KAR2 antibody, heat shock protein family A (Hsp70) member 5 S homeolog antibody, heat shock 70 kDa protein 5a antibody, heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) antibody, heat shock protein 5 antibody, heat shock protein family A member 5 antibody, CpipJ_CPIJ003550 antibody, HSPA5 antibody, grp78 antibody, LOC100533358 antibody, BiP/grp78 antibody, Tc00.1047053506585.40 antibody, Tb11.02.5450 antibody, Tb11.02.5500 antibody, LMJF_28_1200 antibody, KAR2 antibody, LOC100135840 antibody, hspa5.S antibody, hspa5 antibody, Hspa5 antibody
    Background
    HSPA5 (heat shock 70 kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.

    Synonyms: 78 kDa glucose regulated protein antibody|78 kDa glucose-regulated protein antibody| AL022860 antibody|AU019543 antibody|BIP antibody| D2Wsu141e antibody|D2Wsu17e antibody| Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78 antibody|Endoplasmic reticulum lumenal Ca2+ binding protein grp78 antibody|FLJ26106 antibody|Glucose Regulated Protein 78 kDa antibody|GRP 78 antibody|GRP-78 antibody|GRP78 antibody|GRP78_HUMAN antibody|Heat shock 70 kDa protein 5 antibody|Heat Shock 70 kDa Protein 5 antibody|Hsce70 antibody| HSPA 5 antibody|HSPA5 antibody|Immunoglobulin Heavy Chain Binding Protein antibody|Immunoglobulin heavy chain-binding protein antibody|mBiP antibody|MIF2 antibody|Sez7 antibody
    Gene ID
    3309
    UniProt
    P11021
    Pathways
    Thyroid Hormone Synthesis, ER-Nucleus Signaling
You are here:
Support