Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

STAT1 antibody (N-Term)

STAT1 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043938
  • Target See all STAT1 Antibodies
    STAT1 (Signal Transducer and Activator of Transcription 1, 91kDa (STAT1))
    Binding Specificity
    • 43
    • 30
    • 15
    • 13
    • 9
    • 8
    • 6
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 114-143, N-Term
    Reactivity
    • 195
    • 111
    • 78
    • 18
    • 17
    • 16
    • 15
    • 13
    • 11
    • 7
    • 6
    • 5
    • 4
    • 4
    • 2
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 191
    • 22
    • 2
    Rabbit
    Clonality
    • 180
    • 35
    Polyclonal
    Conjugate
    • 117
    • 10
    • 9
    • 7
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    This STAT1 antibody is un-conjugated
    Application
    • 150
    • 66
    • 54
    • 44
    • 38
    • 38
    • 26
    • 23
    • 20
    • 8
    • 6
    • 4
    • 3
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    KILENAQRFN QAQSGNIQST VMLDKQKELD
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: signal transducer and activator of transcription 1, 91 kDa
    Protein Name: Signal transducer and activator of transcription 1-alpha/beta
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product STAT1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).

    Song, Yang, Min, Liu, Zhao: "The effect of procyanidin on expression of STAT1 in type 2 diabetes mellitus SD rats with focal cerebral ischemia." in: Neuro endocrinology letters, Vol. 35, Issue 1, pp. 68-72, (2014) (PubMed).

    Gong, Cao, Jiang, Zhou, Liu: "Hepatitis C virus non-structural 5A abrogates signal transducer and activator of transcription-1 nuclear translocation induced by IFN-alpha through dephosphorylation." in: World journal of gastroenterology, Vol. 13, Issue 30, pp. 4080-4, (2007) (PubMed).

  • Target
    STAT1 (Signal Transducer and Activator of Transcription 1, 91kDa (STAT1))
    Alternative Name
    STAT1 (STAT1 Products)
    Background
    Signal transducer and activator of transcription 1 (STAT1) is a transcription factor which in humans is encoded by the STAT1 gene. The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.

    Synonyms: Signal transducer and activator of transcription 1 91kD antibody|DKFZp686B04100 antibody| ISGF 3 antibody|ISGF-3 antibody|OTTHUMP00000163552 antibody|OTTHUMP00000165046 antibody| OTTHUMP00000165047 antibody|OTTHUMP00000205845 antibody|Signal transducer and activator of transcription 1 91 kDa antibody|Signal transducer and activator of transcription 1 alpha/ beta antibody|Signal transducer and activator of transcription 1 antibody|Signal transducer and activator of transcription 1, 91kD antibody|Signal transducer and activator of transcription 1-alpha/beta antibody|Signal Transductor and Activator of Transcription 1 antibody|STAT 1 antibody|STAT 91 antibody|Stat1 antibody|STAT1_HUMAN antibody|STAT91 antibody|Transcription factor ISGF 3 components p91 p84 antibody|Transcription factor ISGF-3 components p91/p84 antibody
    Gene ID
    6772
    UniProt
    P42224
    Pathways
    JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, CXCR4-mediated Signaling Events
You are here:
Support