UPF3B antibody (UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast)) (AA 416-452)

Details for Product anti-UPF3B Antibody No. ABIN3043956, Supplier: Log in to see
  • HUPF3B
  • MRXS14
  • RENT3B
  • UPF3X
  • 5730594O13Rik
  • AI317193
  • AW541158
  • RGD1560264
  • UPF3B, regulator of nonsense mediated mRNA decay
  • UPF3 regulator of nonsense transcripts homolog B (yeast)
  • UPF3B
  • Upf3b
AA 416-452, C-Term
Human, Mouse (Murine), Rat (Rattus)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Purpose Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human UPF3B /RENT3B (416-452aa SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL).
Isotype IgG
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Regulator of nonsense transcripts 3B(UPF3B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: UPF3 regulator of nonsense transcripts homolog B (yeast)
Protein Name: Regulator of nonsense transcripts 3B
Purification Immunogen affinity purified.
Alternative Name UPF3B (UPF3B Antibody Abstract)
Background Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.

Synonyms: HUPF3B antibody|hUpf3p X antibody|MRXS14 antibody|Nonsense mRNA reducing factor 3B antibody|Regulator of nonsense transcripts 3B antibody|RENT3B antibody|Up-frameshift suppressor 3 homolog B antibody|Up-frameshift suppressor 3 homolog on chromosome X antibody| UPF3 regulator of nonsense transcripts homolog B (yeast) antibody|UPF3 regulator of nonsense transcripts homolog B antibody|UPF3B antibody|UPF3X antibody
Gene ID 65109
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
Supplier Images
Western Blotting (WB) image for anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (AA 416-452), (C-Term) antibody (ABIN3043956) anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (AA 416-452), (C-Term) antibody
Immunohistochemistry (IHC) image for anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (AA 416-452), (C-Term) antibody (ABIN3043956) Anti- UPF3B/RENT3B Picoband antibody, IHC(P) IHC(P): Rat Testis Tissue
Immunohistochemistry (IHC) image for anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (AA 416-452), (C-Term) antibody (ABIN3043956) Anti- UPF3B/RENT3B Picoband antibody, IHC(P) IHC(P): Mouse Testis Tissue
Immunohistochemistry (IHC) image for anti-UPF3 Regulator of Nonsense Transcripts Homolog B (Yeast) (UPF3B) (AA 416-452), (C-Term) antibody (ABIN3043956) Anti- UPF3B/RENT3B Picoband antibody, IHC(P) IHC(P): Human Placenta Tissue
Did you look for something else?