BCAR3 antibody (C-Term)
-
- Target See all BCAR3 Antibodies
- BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))
-
Binding Specificity
- AA 791-825, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BCAR3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Breast cancer anti-estrogen resistance protein 3(BCAR3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- KGAQVNQTER YEKFNQILTA LSRKLEPPPV KQAEL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Breast cancer anti-estrogen resistance protein 3(BCAR3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: breast cancer anti-estrogen resistance 3
Protein Name: Breast cancer anti-estrogen resistance protein 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product BCAR3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))
- Alternative Name
- BCAR3 (BCAR3 Products)
- Synonyms
- NSP2 antibody, SH2D3B antibody, AI131758 antibody, AND-34 antibody, BCAR3 antibody, breast cancer anti-estrogen resistance 3 antibody, breast cancer anti-estrogen resistance 3 L homeolog antibody, BCAR3 antibody, Bcar3 antibody, bcar3 antibody, bcar3.L antibody
- Background
-
Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: BCAR 3 antibody|BCAR3 antibody|BCAR3_HUMAN antibody|Breast cancer anti estrogen resistance 3 antibody|Breast cancer anti estrogen resistance protein 3 antibody|Breast cancer anti-estrogen resistance protein 3 antibody|Breast cancer antiestrogen resistance 3 antibody|dJ1033H22.2 antibody|dJ1033H22.2 breast cancer anti estrogen resistance 3 antibody|dJ1033H22.2 breast cancer antiestrogen resistance 3 antibody|KIAA0554 antibody|Novel SH2 containing protein 2 antibody|Novel SH2-containing protein 2 antibody|NSP 2 antibody|NSP2 antibody|SH2 containing protein Nsp2 antibody|SH2 domain containing protein 3B antibody|SH2 domain-containing protein 3B antibody|SH2D3B antibody - Gene ID
- 8412
- UniProt
- O75815
-