AFF4 antibody (N-Term)
-
- Target See all AFF4 Antibodies
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
-
Binding Specificity
- AA 6-53, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AFF4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
- Sequence
- RNVLRMKERE RRNQEIQQGE DAFPPSSPLF AEPYKVTSKE DKLSSRIQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection. Tested with WB in Human.
Gene Name: AF4/FMR2 family member 4
Protein Name: AF4/FMR2 family member 4 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product AFF4 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AFF4 (AF4/FMR2 Family, Member 4 (AFF4))
- Alternative Name
- AFF4 (AFF4 Products)
- Synonyms
- AFF4 antibody, RA_m002_jsmFBA6Br antibody, AF5Q31 antibody, MCEF antibody, Alf4 antibody, Laf4l antibody, AF4/FMR2 family member 4 L homeolog antibody, AF4/FMR2 family member 4 antibody, AF4/FMR2 family, member 4 antibody, aff4.L antibody, AFF4 antibody, aff4 antibody, Aff4 antibody
- Background
-
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
Synonyms: AF5Q31 | Alf4 | CHOPS | HSPC092 | Laf4 | MCEF | Q9UHB7 - Gene ID
- 27125
-