ALDH7A1 antibody (C-Term)

Catalog No. ABIN4886452

Product Details anti-ALDH7A1 Antibody

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Binding Specificity: AA 333-369, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH7A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: ARRLFIHESI HDEVVNRLKK AYAQIRVGNP WDPNVLY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aldehyde dehydrogenase 7 family member A1
Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ALDH7A1

Target: ALDH7A1 (Aldehyde Dehydrogenase 7 Family, Member A1 (ALDH7A1))

Alternative Name: ALDH7A1 (ALDH7A1 Products)

Synonyms: atq1 antibody, ALDH7A1 antibody, ATQ1 antibody, EPD antibody, PDE antibody, antiquitin antibody, ATQ antibody, wu:fi34d12 antibody, wu:fi35e06 antibody, Atq1 antibody, D18Wsu181e antibody, aldehyde dehydrogenase 7 family member A1 antibody, aldehyde dehydrogenase 7 family member A1 L homeolog antibody, aldehyde dehydrogenase 7 family, member A1 antibody, aldehyde dehydrogenase family 7, member A1 antibody, ALDH7A1 antibody, aldh7a1 antibody, aldh7a1.L antibody, Aldh7a1 antibody

Background: Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Synonyms: ALDH7A1 | Antiquitin 1 | Antiquitin | Antiquitin-1 | ATQ1 | EPD | PDE | P49419

Gene ID: 501

UniProt: P49419

Pathways: Sensory Perception of Sound