Insulin Receptor antibody (N-Term)

Catalog No. ABIN4886636

Product Details anti-Insulin Receptor Antibody

Target: Insulin Receptor (INSR)

Binding Specificity: AA 38-76, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Insulin Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.

Sequence: MDIRNNLTRL HELENCSVIE GHLQILLMFK TRPEDFRDL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Insulin receptor(INSR) detection. Tested with WB in Human,Rat.
Gene Name: insulin receptor
Protein Name: Insulin receptor

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Insulin Receptor (38-76aa MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Insulin Receptor antibody (ABIN4886636)

Wang, Sun, Li, Dong, Li, Zhao: "Resveratrol attenuates intermittent hypoxia-induced insulin resistance in rats: involvement of Sirtuin 1 and the phosphatidylinositol-4,5-bisphosphate 3-kinase/AKT pathway." in: Molecular medicine reports, Vol. 11, Issue 1, pp. 151-8, (2014) (PubMed).

Target Details for Insulin Receptor

Target: Insulin Receptor (INSR)

Alternative Name: INSR (INSR Products)

Synonyms: CD220 antibody, HHF5 antibody, 4932439J01Rik antibody, D630014A15Rik antibody, IR antibody, IR-A antibody, IR-B antibody, 18402 antibody, CG18402 antibody, DIHR antibody, DILR antibody, DIR antibody, DIRH antibody, DIRbeta antibody, DInR antibody, DInr antibody, Dir-a antibody, Dir-b antibody, Dmel\\CG18402 antibody, INR antibody, INS antibody, Inr antibody, Inr-alpha antibody, Inr-beta antibody, InsR antibody, dINR antibody, dIR antibody, dIRH antibody, dInR antibody, dInr antibody, dInsR antibody, dinr antibody, dir antibody, er10 antibody, inr antibody, insulin/insulin-like growth factor receptor antibody, l(3)05545 antibody, l(3)93Dj antibody, l(3)er10 antibody, lnR antibody, ir-A antibody, CTK-1 antibody, ir antibody, INSR antibody, NV14476 antibody, cd220 antibody, hhf5 antibody, insulin receptor antibody, Insulin-like receptor antibody, insulin receptor L homeolog antibody, INSR antibody, Insr antibody, InR antibody, LOC100122567 antibody, LOC100451802 antibody, insr.L antibody

Background: INSR(INSULIN RECEPTOR) is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

Synonyms: CD 220 | CD220 | HHF5 | HIR A | insulin receptor | INSR alpha | insulin receptor a | Insulin Receptor alpha | Insulin receptor subunit alpha | Insulin receptor subunit beta | Insulin receptor(IR) | InsulinReceptor | Insulinreceptor(IR) | IR 1 | P06213

Gene ID: 3643

UniProt: P06213

Pathways: NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity