LRIG3 antibody (Middle Region)

Catalog No. ABIN4886661

Product Details anti-LRIG3 Antibody

Target: LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))

Binding Specificity: AA 428-465, Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRIG3 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.

Sequence: NAFSQMKKLQ QLHLNTSSLL CDCQLKWLPQ WVAENNFQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection. Tested with WB in Human,Rat.
Gene Name: leucine rich repeats and immunoglobulin like domains 3
Protein Name: Leucine-rich repeats and immunoglobulin-like domains protein 3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for LRIG3

Target: LRIG3 (Leucine-Rich Repeats and Immunoglobulin-Like Domains 3 (LRIG3))

Alternative Name: LRIG3 (LRIG3 Products)

Synonyms: LRIG3 antibody, lrig3 antibody, GB17149 antibody, LIG3 antibody, 9030421L11Rik antibody, 9130004I02Rik antibody, 9430095K15Rik antibody, mKIAA3016 antibody, RGD1561255 antibody, leucine rich repeats and immunoglobulin like domains 3 antibody, leucine-rich repeats and immunoglobulin-like domains 3 antibody, leucine-rich repeats and immunoglobulin-like domains protein 3 antibody, leucine-rich repeats and immunoglobulin like domains 3 S homeolog antibody, leucine-rich repeats and immunoglobulin like domains 3 antibody, LRIG3 antibody, lrig3 antibody, LOC726128 antibody, lrig3.S antibody, Lrig3 antibody

Background: LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8 % and 54.0 % amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.

Synonyms: LIG-3 | LIG3 | LRIG1-3 | Lrig3 | Q6UXM1

Gene ID: 121227