PA2G4 antibody (C-Term)

Catalog No. ABIN4886688

Product Details anti-PA2G4 Antibody

Target: PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))

Binding Specificity: AA 138-178, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PA2G4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RKADVIKAAH LCAEAALRLV KPGNQNTQVT EAWNKVAHSF N

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: proliferation-associated 2G4
Protein Name: Proliferation-associated protein 2G4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PA2G4

Target: PA2G4 (Proliferation-Associated 2G4, 38kDa (PA2G4))

Alternative Name: PA2G4 (PA2G4 Products)

Synonyms: EBP1 antibody, HG4-1 antibody, p38-2G4 antibody, Ebp1 antibody, pa2g4 antibody, si:dz150i12.2 antibody, wu:fb19b11 antibody, wu:ft56d05 antibody, zgc:86732 antibody, ebp1 antibody, hg4-1 antibody, p38-2g4 antibody, pa2g4-a antibody, PA2G4 antibody, DKFZp469G2132 antibody, Pa2g4 antibody, MGC81621 antibody, 38kDa antibody, AA672939 antibody, Plfap antibody, proliferation-associated 2G4 antibody, proliferation-associated 2G4, a antibody, proliferation-associated 2G4, 38kDa antibody, proliferation-associated 2G4 L homeolog antibody, proliferation-associated protein 2G4 antibody, proliferation-associated 2G4 S homeolog antibody, proliferation-associated protein 2G4 pseudogene antibody, PA2G4 antibody, Pa2g4 antibody, pa2g4a antibody, pa2g4.L antibody, pa2g4 antibody, LOC100519773 antibody, pa2g4.S antibody, LOC693641 antibody

Background: Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases.

Synonyms: hG4 1 | hG4-1 | Mpp1 | p38 2G4 | Pa2g4 | Plfap | Q9UQ80

Gene ID: 5036

Pathways: Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Toll-Like Receptors Cascades