PIAS4 antibody (N-Term)

Catalog No. ABIN4886695

Product Details anti-PIAS4 Antibody

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Binding Specificity: AA 130-174, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIAS4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.

Sequence: EVRLVKLPFF NMLDELLKPT ELVPQNNEKL QESPCIFALT PRQVE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: protein inhibitor of activated STAT, 4
Protein Name: E3 SUMO-protein ligase PIAS4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PIAS4

Target: PIAS4 (Protein Inhibitor of Activated STAT, 4 (PIAS4))

Alternative Name: PIAS4 (PIAS4 Products)

Synonyms: PIASY antibody, Piasg antibody, ZMIZ6 antibody, pias4 antibody, piasy antibody, wu:fc54c11 antibody, wu:fi18c10 antibody, wu:fi20e09 antibody, wu:fk93f11 antibody, zgc:66410 antibody, piasg antibody, zmiz6 antibody, LOC100219439 antibody, Pias-gamma antibody, pias4l antibody, wu:fi26h11 antibody, zgc:63923 antibody, protein inhibitor of activated STAT 4 antibody, protein inhibitor of activated STAT, 4 antibody, protein inhibitor of activated STAT, 4a antibody, protein inhibitor of activated STAT 4 L homeolog antibody, protein inhibitor of activated STAT, 4b antibody, PIAS4 antibody, Pias4 antibody, pias4a antibody, pias4.L antibody, pias4 antibody, pias4b antibody

Background: E3 SUMO-protein ligase PIAS4, also known as protein inhibitor of activated STAT protein 4 (PIAS4) or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in gene silencing.

Synonyms: E3 SUMOprotein ligase PIAS4 | E3 SUMO-protein ligase PIAS4 | PIASG | PIASgamma | PIAS-gamma | PIASy | Q8N2W9

Gene ID: 51588

UniProt: Q8N2W9

Pathways: JAK-STAT Signaling, Interferon-gamma Pathway, Positive Regulation of Response to DNA Damage Stimulus