FABP4 antibody

Catalog No. ABIN4950979

Product Details anti-FABP4 Antibody

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KLVSSENFDDYMKEVGVGFATRKVAGMAKPN of human FABP4 were used as the immunogen for the FABP4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FABP4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FABP4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FABP4

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Alternative Name: FABP4 (FABP4 Products)

Synonyms: A-FABP antibody, AFABP antibody, ALBP antibody, aP2 antibody, LOC100223994 antibody, FABP antibody, AP2 antibody, FABP3 antibody, FABP4 antibody, MGC84940 antibody, fabp4 antibody, 422/aP2 antibody, ALBP/Ap2 antibody, Ap2 antibody, Lbpl antibody, Albp antibody, fatty acid binding protein 4 antibody, fatty acid-binding protein, adipocyte antibody, fatty acid binding protein 4, adipocyte antibody, fatty acid binding protein 4, adipocyte L homeolog antibody, Fatty acid-binding protein, adipocyte antibody, adipocyte fatty acid-binding protein antibody, adipocyte fatty acid binding protein antibody, FABP4 antibody, LOC100223994 antibody, fabp4.L antibody, fabp4 antibody, Fabp4 antibody, LOC100732353 antibody, LOC100861279 antibody, LOC100057425 antibody, LOC395224 antibody

Background: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

UniProt: P15090

Pathways: Brown Fat Cell Differentiation