-
- Target See all ADRBK2 Antibodies
- ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADRBK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR of human GRK3/ADRBK2 were used as the immunogen for the GRK3 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ADRBK2 Primary Antibody
-
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (AA 1-300) antibody
ADRBK2 Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (AA 343-480) antibodyADRBK2 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (Internal Region) antibodyADRBK2 Reactivity: Human, Mouse, Rat WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (AA 29-57), (N-Term) antibodyADRBK2 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB21107 unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) antibodyADRBK2 Reactivity: Human, Rat ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) antibodyADRBK2 Reactivity: Human, Mouse, Rat IHC Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (N-Term) antibodyADRBK2 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (AA 524-552), (C-Term) antibodyADRBK2 Reactivity: Human, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (AA 36-65), (N-Term) antibodyADRBK2 Reactivity: Human WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-Adrenergic, Beta, Receptor Kinase 2 (ADRBK2) (Internal Region) antibodyADRBK2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the GRK3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the GRK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))
- Alternative Name
- GRK3 / ADRBK2 (ADRBK2 Products)
- Synonyms
- bark2 antibody, grk3 antibody, 4833444A01Rik antibody, AI851927 antibody, AW551196 antibody, Adrbk-2 antibody, Bark-2 antibody, GRK3 antibody, BARK2 antibody, Grk3 antibody, si:dz221d18.1 antibody, G protein-coupled receptor kinase 3 antibody, GRK3 antibody, grk3 antibody, Grk3 antibody
- Background
- Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
- UniProt
- P35626
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling
-
You are here:
