HKDC1 antibody

Catalog No. ABIN4951305

Product Details anti-HKDC1 Antibody

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HKDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HKDC1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HKDC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HKDC1

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Alternative Name: HKDC1 (HKDC1 Products)

Synonyms: cb370 antibody, sb:cb370 antibody, HKDC1 antibody, BC016235 antibody, hexokinase domain containing 1 antibody, putative hexokinase HKDC1 antibody, hkdc1 antibody, HKDC1 antibody, LOC100088018 antibody, Hkdc1 antibody

Background: HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

UniProt: Q2TB90