HSP90AA1 antibody

Catalog No. ABIN4951372

Product Details anti-HSP90AA1 Antibody

Target: HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP90AA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ of human HSP90AA1 were used as the immunogen for the HSP90 alpha antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HSP90 alpha antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HSP90 alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HSP90AA1

Target: HSP90AA1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class A Member 1 (HSP90AA1))

Alternative Name: HSP90 alpha / HSP90AA1 (HSP90AA1 Products)

Synonyms: EL52 antibody, HSP86 antibody, HSP89A antibody, HSP90A antibody, HSP90N antibody, HSPC1 antibody, HSPCA antibody, HSPCAL1 antibody, HSPCAL4 antibody, HSPN antibody, Hsp89 antibody, Hsp90 antibody, LAP2 antibody, Hsp86 antibody, Hspca antibody, htpG antibody, 86kDa antibody, 89kDa antibody, AL024080 antibody, AL024147 antibody, Hsp86-1 antibody, hsp4 antibody, HSP90 antibody, HSP90AA1 antibody, fb17b01 antibody, hsp90 antibody, hsp90a antibody, hsp90a.1 antibody, hsp90alpha antibody, wu:fb17b01 antibody, zgc:86652 antibody, Hsp90alpha antibody, heat shock protein 90 alpha family class A member 1 antibody, heat shock protein 90, alpha (cytosolic), class A member 1 antibody, Heat Shock Protein 90, cytosolic antibody, heat shock protein 90A antibody, molecular chaperone antibody, heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 antibody, heat shock protein HSP 90-alpha antibody, heat shock protein 90kDa alpha (cytosolic), class A member 1 antibody, HSP90AA1 antibody, Hsp90aa1 antibody, HSP90A antibody, hsp90A antibody, hsp90aa1.1 antibody, LOC108698781 antibody

Background: Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90- kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85 % amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.

UniProt: P07900

Pathways: M Phase, Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals