HSP90AB1 antibody

Catalog No. ABIN4951373

Product Details anti-HSP90AB1 Antibody

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSP90AB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HSP90 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HSP90AB1

Target: HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))

Alternative Name: HSP90 beta / HSP90AB1 (HSP90AB1 Products)

Synonyms: D6S182 antibody, HSP84 antibody, HSP90B antibody, HSPC2 antibody, HSPCB antibody, GRP94 antibody, TRA1 antibody, hsp90b antibody, 90kDa antibody, AL022974 antibody, C81438 antibody, Hsp84 antibody, Hsp84-1 antibody, Hsp90 antibody, Hspcb antibody, Hsp70 antibody, Hsp70-1 antibody, Hsp70.1 antibody, hsp68 antibody, HSP90-BETA antibody, hsp90beta antibody, wu:fa29f01 antibody, wu:fa91e11 antibody, wu:fd59e11 antibody, wu:gcd22h07 antibody, HSP90 antibody, heat shock protein 90 alpha family class B member 1 antibody, heat shock protein 90 beta family member 1 antibody, Heat Shock Protein 90, endoplasmic reticulum antibody, heat shock protein 90B antibody, heat shock protein 90 alpha (cytosolic), class B member 1 antibody, heat shock protein 1B antibody, heat shock protein 90kDa alpha family class B member 1 S homeolog antibody, heat shock protein 90, alpha (cytosolic), class B member 1 antibody, HSP90AB1 antibody, HSP90B1 antibody, HSP90B antibody, hsp90ab1 antibody, Hsp90ab1 antibody, Hspa1b antibody, hsp90ab1.S antibody

Background: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

UniProt: P08238

Pathways: Regulation of Cell Size