Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HSP90AB1 antibody

HSP90AB1 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4951373
  • Target See all HSP90AB1 Antibodies
    HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))
    Reactivity
    • 128
    • 90
    • 80
    • 15
    • 14
    • 14
    • 11
    • 9
    • 8
    • 6
    • 6
    • 5
    • 4
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 100
    • 27
    • 1
    Rabbit
    Clonality
    • 99
    • 29
    Polyclonal
    Conjugate
    • 72
    • 8
    • 6
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This HSP90AB1 antibody is un-conjugated
    Application
    • 101
    • 45
    • 43
    • 31
    • 23
    • 22
    • 21
    • 17
    • 15
    • 14
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity
    Immunogen
    Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.
    Isotype
    IgG
    Top Product
    Discover our top product HSP90AB1 Primary Antibody
  • Application Notes
    Optimal dilution of the HSP90 beta antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    HSP90AB1 (Heat Shock Protein 90kDa alpha (Cytosolic), Class B Member 1 (HSP90AB1))
    Alternative Name
    HSP90 beta / HSP90AB1 (HSP90AB1 Products)
    Synonyms
    D6S182 antibody, HSP84 antibody, HSP90B antibody, HSPC2 antibody, HSPCB antibody, GRP94 antibody, TRA1 antibody, hsp90b antibody, 90kDa antibody, AL022974 antibody, C81438 antibody, Hsp84 antibody, Hsp84-1 antibody, Hsp90 antibody, Hspcb antibody, Hsp70 antibody, Hsp70-1 antibody, Hsp70.1 antibody, hsp68 antibody, HSP90-BETA antibody, hsp90beta antibody, wu:fa29f01 antibody, wu:fa91e11 antibody, wu:fd59e11 antibody, wu:gcd22h07 antibody, HSP90 antibody, heat shock protein 90 alpha family class B member 1 antibody, heat shock protein 90 beta family member 1 antibody, Heat Shock Protein 90, endoplasmic reticulum antibody, heat shock protein 90B antibody, heat shock protein 90 alpha (cytosolic), class B member 1 antibody, heat shock protein 1B antibody, heat shock protein 90kDa alpha family class B member 1 S homeolog antibody, heat shock protein 90, alpha (cytosolic), class B member 1 antibody, HSP90AB1 antibody, HSP90B1 antibody, HSP90B antibody, hsp90ab1 antibody, Hsp90ab1 antibody, Hspa1b antibody, hsp90ab1.S antibody
    Background
    Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family, these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
    UniProt
    P08238
    Pathways
    Regulation of Cell Size
You are here:
Support