IGFBPI antibody

Catalog No. ABIN4951423

Product Details anti-IGFBPI Antibody

Target: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGFBPI antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purification: Antigen affinity

Immunogen: Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IGFBP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IGFBP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IGFBPI

Target: IGFBPI (Insulin-Like Growth Factor Binding Protein 1 (IGFBPI))

Alternative Name: IGFBP1 (IGFBPI Products)

Synonyms: cb656 antibody, igfbp1 antibody, IGFBP-1 antibody, MGC68538 antibody, afbp antibody, ibp1 antibody, pp12 antibody, igf-bp25 antibody, higfbp-1 antibody, IGFBP1 antibody, LOC100223208 antibody, LOC100305121 antibody, AFBP antibody, IBP1 antibody, IGF-BP25 antibody, PP12 antibody, hIGFBP-1 antibody, IGFBA antibody, insulin like growth factor binding protein 1 antibody, insulin-like growth factor binding protein 1a antibody, insulin like growth factor binding protein 1 S homeolog antibody, insulin like growth factor binding protein 1 L homeolog antibody, insulin-like growth factor binding protein 1 antibody, IGFBP1 antibody, igfbp1a antibody, igfbp1.S antibody, igfbp1.L antibody, igfbp1 antibody, LOC100305121 antibody, Igfbp1 antibody

Background: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

UniProt: P47876

Pathways: Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Growth Factor Binding