LCAT antibody

Catalog No. ABIN4951595

Product Details anti-LCAT Antibody

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCAT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LCAT antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LCAT

Target: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Alternative Name: LCAT (LCAT Products)

Synonyms: AI046659 antibody, D8Wsu61e antibody, MGC82035 antibody, lcat antibody, MGC88964 antibody, LCAT antibody, lecithin-cholesterol acyltransferase antibody, lecithin cholesterol acyltransferase antibody, lecithin-cholesterol acyltransferase L homeolog antibody, solute carrier family 12 member 4 antibody, fragile site, aphidicolin type, common, fra(13)(q13.2) antibody, LCAT antibody, Lcat antibody, lcat.L antibody, lcat antibody, SLC12A4 antibody, FRA13A antibody

Background: LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).

UniProt: P16301

Pathways: Lipid Metabolism