LOXL2 antibody

Catalog No. ABIN4951635

Product Details anti-LOXL2 Antibody

Target: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LOXL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ of human Lysyl oxidase homolog 2 were used as the immunogen for the LOXL2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LOXL2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LOXL2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LOXL2

Target: LOXL2 (Lysyl Oxidase-Like 2 (LOXL2))

Alternative Name: LOXL2 (LOXL2 Products)

Synonyms: LOR2 antibody, WS9-14 antibody, CG4402 antibody, Dmel\\CG4402 antibody, Dmloxl-2 antibody, dmlox-2 antibody, 1110004B06Rik antibody, 4930526G11Rik antibody, 9430067E15Rik antibody, GB13360 antibody, lox2-like antibody, LOXL2 antibody, lor2 antibody, loxl-2 antibody, ws9-14 antibody, im:7136137 antibody, si:dkeyp-32b1.1 antibody, wu:fk12g04 antibody, zgc:158414 antibody, lysyl oxidase like 2 antibody, lysyl oxidase-like 2 antibody, lysyl oxidase homolog 4 antibody, lysyl oxidase like 2 L homeolog antibody, lysyl oxidase-like 2b antibody, LOXL2 antibody, lox2 antibody, Loxl2 antibody, LOC408544 antibody, loxl2.L antibody, loxl2 antibody, loxl2b antibody

Background: Lysyl oxidase homolog 2 is an enzyme that in humans is encoded by the LOXL2 gene. This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. LOXL2 can also crosslink collagen type IV and hence influence the sprouting of new blood vessels.

UniProt: Q9Y4K0

Pathways: Chromatin Binding