NDRG2 antibody
-
- Target See all NDRG2 Antibodies
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDRG2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- Amino acids NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER of human NDRG2 were used as the immunogen for the NDRG2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product NDRG2 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the NDRG2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the NDRG2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Alternative Name
- NDRG2 (NDRG2 Products)
- Synonyms
- NDRG2 antibody, AI182517 antibody, AU040374 antibody, Ndr2 antibody, SYLD antibody, im:6909381 antibody, si:dkey-88n24.1 antibody, zgc:101847 antibody, NDRG family member 2 antibody, N-myc downstream regulated gene 2 antibody, NDRG family member 2 S homeolog antibody, ndrg2 antibody, NDRG2 antibody, Ndrg2 antibody, ndrg2.S antibody
- Background
- NDRG2 contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt]
- UniProt
- Q9UN36
-