NDRG2 antibody

Catalog No. ABIN4951848

Product Details anti-NDRG2 Antibody

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDRG2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER of human NDRG2 were used as the immunogen for the NDRG2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the NDRG2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NDRG2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NDRG2

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Alternative Name: NDRG2 (NDRG2 Products)

Synonyms: NDRG2 antibody, AI182517 antibody, AU040374 antibody, Ndr2 antibody, SYLD antibody, im:6909381 antibody, si:dkey-88n24.1 antibody, zgc:101847 antibody, NDRG family member 2 antibody, N-myc downstream regulated gene 2 antibody, NDRG family member 2 S homeolog antibody, ndrg2 antibody, NDRG2 antibody, Ndrg2 antibody, ndrg2.S antibody

Background: NDRG2 contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation. [UniProt]

UniProt: Q9UN36